PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_116862g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 312aa    MW: 35633.6 Da    PI: 5.9679
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_116862g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.1e-141966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed +l +++k +G g Wk  +++ g++R++k+c++rw++yl
   MA_116862g0010 19 RGAWTGSEDRILSEYIKTHGVGGWKDLPKKAGLKRCGKSCRLRWLNYL 66
                     89********************************************97 PP

2Myb_DNA-binding551.9e-1772117148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE+ellv+++++lG++ W++Ia +++  Rt++++k++w+++l
   MA_116862g0010  72 RGNISPEEEELLVRLHRLLGNR-WSLIAGRLP-SRTDNEIKNYWNTHL 117
                      7899******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7861466IPR017930Myb domain
SuperFamilySSF466891.58E-2717113IPR009057Homeodomain-like
SMARTSM007171.1E-111868IPR001005SANT/Myb domain
PfamPF002491.0E-121966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-222073IPR009057Homeodomain-like
CDDcd001679.77E-92166No hitNo description
PROSITE profilePS5129426.33967121IPR017930Myb domain
SMARTSM007173.6E-1771119IPR001005SANT/Myb domain
PfamPF002491.2E-1572117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2574121IPR009057Homeodomain-like
CDDcd001678.20E-1376117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGRSPSCSSC CKHEESLNRG AWTGSEDRIL SEYIKTHGVG GWKDLPKKAG LKRCGKSCRL  60
RWLNYLRPDI KRGNISPEEE ELLVRLHRLL GNRWSLIAGR LPSRTDNEIK NYWNTHLSKR  120
VQMGEFEPRF QRPVKRRGIP SPSDCDEEGV VDKDKYISRT LPLKTRALRY CGTAVGDGGS  180
YDYDHVPDTH DGIDEEEDLK AEDDHVVEID TSKSWSQLLL EDCMADYQYD QVQANNGLQP  240
NSMLSTSNGT DDHHQSPSLS QSIILKENHS SSYCNLMDQE FPSSKDFNSS YFDSFLDLGE  300
LSISLSFFHR LY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-241712125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131136RPVKRR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU1312180.0KU131218.1 Picea abies transcription factor MYB29 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLR4HES61e-171R4HES6_PICAB; TT2-like protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.19e-48myb domain protein 3